PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g034080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 287aa    MW: 31332.1 Da    PI: 8.8442
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g034080.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.11.8e-3260114459
       ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                        rY+eClkNhAa++Gg+++DGCgEfmps geegt +alkCaAC+CHRnFHR+e  +
  Sopen04g034080.1  60 GRYRECLKNHAANIGGNVTDGCGEFMPS-GEEGTLEALKCAACNCHRNFHRKEIPN 114
                       69*************************9.999********************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015666.7E-3161112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047709.2E-3061112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257744.0E-2261112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.71562111IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.6E-16212273IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28212274IPR009057Homeodomain-like
TIGRFAMsTIGR015652.3E-28216273IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MALGGGNEEK EMRISGFQNI DLVSPGGGAA PDVVVVGAAP HNNSTTGSNK LNKGTSTVRG  60
RYRECLKNHA ANIGGNVTDG CGEFMPSGEE GTLEALKCAA CNCHRNFHRK EIPNNVGGVG  120
GDNNNNAGIM VVHPLQLPQP LPSPLPSLNH HHHHHHQHGG RSIWTTMPPQ PVKMAFGGSG  180
GGSGATDSSS EELNFNTYHH QQATSVPPQQ PFMLAKKRFR TKFSQEQKEK MLEFAEKLGW  240
RIPREDDTEV QRFCSQVGVK RQVFKVWMHN NKNPSSAKKN IIQEDQP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-252172761879ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015072005.10.0PREDICTED: zinc-finger homeodomain protein 5
TrEMBLK4BVC81e-172K4BVC8_SOLLC; Uncharacterized protein
STRINGSolyc04g080490.2.11e-172(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.25e-54homeobox protein 31